PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT33273
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Nin-like
Protein Properties Length: 346aa    MW: 39900.3 Da    PI: 9.7005
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT33273genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.91.3e-25199248352
    RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
               ++i+l d++ yF+lpi++A++ L++++++LK++CRqyGI+RWPhRkiksl
  EMT33273 199 ASITLADIAPYFHLPIREASRALKIGVSILKQKCRQYGIPRWPHRKIKSL 248
               78**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151920.214183268IPR003035RWP-RK domain
PfamPF020429.0E-21200248IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGTSSPMLRE SQRWGVTTST LTSSPDEVVV DVKRLYWSVA ATMRSFLHRT TLFFLSTGLT  60
LRASIGEAVQ EAVERATQRA LFSHTGNPSW TWLSRGSNNT GELINVKEGR PRWNPGLVCV  120
PSLYNDLYMV YQFQKFQQVP ELVKRDSDEK STRLDAEDKT CDVEVKEESG SDSDEDPQSG  180
EELPAHVARR RRAKKQHIAS ITLADIAPYF HLPIREASRA LKIGVSILKQ KCRQYGIPRW  240
PHRKIKSLDS LISDLEFVMD DTDGDVVQKE TSRQREKERE KEKEKEKEKE KEKQEAIQAL  300
AKRKRLLESE KEIIQQKPAL DLMAETKLFR EDVFKRRYRA KRLPGH
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3723870.0AK372387.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3001B21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006653678.17e-86PREDICTED: LOW QUALITY PROTEIN: protein RKD5
TrEMBLM8CGB60.0M8CGB6_AEGTA; Uncharacterized protein
STRINGMLOC_11130.21e-129(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106733142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.18e-31RWP-RK domain-containing protein